Recombinant Full Length Human TRMT112 Protein, GST-tagged
Cat.No. : | TRMT112-5654HF |
Product Overview : | Human HSPC152 full-length ORF ( AAH17172, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 125 amino acids |
Description : | TRMT112 (TRNA Methyltransferase 11-2 Homolog (S. Cerevisiae)) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include protein methyltransferase activity. |
Molecular Mass : | 39.49 kDa |
AA Sequence : | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | TRMT112 |
Synonyms | TRMT112; tRNA methyltransferase 11-2 homolog (S. cerevisiae); tRNA methyltransferase 112 homolog; HSPC152; HSPC170; TRM112; TRMT11 2; TRM112-like protein; TRMT11-2; |
Gene ID | 51504 |
mRNA Refseq | NM_016404 |
Protein Refseq | NP_057488 |
MIM | 618630 |
UniProt ID | Q9UI30 |
◆ Recombinant Proteins | ||
TRMT112-5269H | Recombinant Human TRMT112 Protein, GST-tagged | +Inquiry |
TRMT112-1148H | Recombinant Human TRMT112 Protein (1-125 aa), His-SUMO-tagged | +Inquiry |
TRMT112-2892Z | Recombinant Zebrafish TRMT112 | +Inquiry |
TRMT112-1958HFL | Recombinant Full Length Human TRMT112 Protein, C-Flag-tagged | +Inquiry |
TRMT112-1645H | Recombinant Human TRMT112 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMT112-756HCL | Recombinant Human TRMT112 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRMT112 Products
Required fields are marked with *
My Review for All TRMT112 Products
Required fields are marked with *
0
Inquiry Basket