Recombinant Full Length Human TRMT6 Protein, C-Flag-tagged
Cat.No. : | TRMT6-1634HFL |
Product Overview : | Recombinant Full Length Human TRMT6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the tRNA methyltransferase 6 protein family. A similar protein in yeast is part of a two component methyltransferase, which is involved in the posttranslational modification that produces the modified nucleoside 1-methyladenosine in tRNAs. Modified 1-methyladenosine influences initiator methionine stability and may be involved in the replication of human immunodeficiency virus type 1. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTS GGSLQPKKKREEPTAETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTE FAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGNKMIVMETCA GLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPK DSALVEESNGTLEEKQASEQENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQ EEQRKRHLEAAALLSERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGV INLRLSETWLRNYQVLPDRSHPKLLMSGGGGYLLSGFTVAMDNLKADTSLKSNASTLESHETEEPAAKKR KCPESDSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TRMT6 tRNA methyltransferase 6 non-catalytic subunit [ Homo sapiens (human) ] |
Official Symbol | TRMT6 |
Synonyms | GCD10; CGI-09; Gcd10p |
Gene ID | 51605 |
mRNA Refseq | NM_015939.5 |
Protein Refseq | NP_057023.2 |
UniProt ID | Q9UJA5 |
◆ Recombinant Proteins | ||
TRMT6-2262H | Recombinant Human TRMT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMT6-2721C | Recombinant Chicken TRMT6 | +Inquiry |
TRMT6-4984R | Recombinant Rhesus monkey TRMT6 Protein, His-tagged | +Inquiry |
Trmt6-6668M | Recombinant Mouse Trmt6 Protein, Myc/DDK-tagged | +Inquiry |
TRMT6-4798R | Recombinant Rhesus Macaque TRMT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMT6-342HCL | Recombinant Human TRMT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRMT6 Products
Required fields are marked with *
My Review for All TRMT6 Products
Required fields are marked with *
0
Inquiry Basket