Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 9(Tnfsf9) Protein, His-Tagged
Cat.No. : | RFL9702HF |
Product Overview : | Recombinant Full Length Human Tumor necrosis factor ligand superfamily member 9(TNFSF9) Protein (P41273) (1-254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-254) |
Form : | Lyophilized powder |
AA Sequence : | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TNFSF9 |
Synonyms | 4 1BB L; 4 1BB ligand; 4 1BBL; 4-1BB ligand; 4-1BBL; Cd137l; Cd157l; Homolog of mouse 4 1BB L; Homolog of mouse 4 1BBL; ILA ligand (TNF related); Ly63l; Receptor 4 1BB ligand; TNF superfamily member 9; TNFL9_HUMAN; Tnfsf9; TNLG5A; Tumor necrosis factor (l |
UniProt ID | P41273 |
◆ Recombinant Proteins | ||
TNFSF9-719H | Active Recombinant Human TNFSF9 Protein, Fc-tagged | +Inquiry |
TNFSF9-717HF | Recombinant Human TNFSF9 Protein, Fc-tagged, FITC conjugated | +Inquiry |
TNFSF9-70H | Recombinant Human TNFSF9 Protein, His-tagged | +Inquiry |
TNFSF9-1013R | Recombinant Rhesus TNFSF9 Protein (Arg128-Glu311), HlgG1 Fc-tagged | +Inquiry |
4-1BB-L-516H | Active Recombinant Human TNFSF9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
TNFSF9-1444RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF9 Products
Required fields are marked with *
My Review for All TNFSF9 Products
Required fields are marked with *