Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 9(Tnfsf9) Protein, His-Tagged
| Cat.No. : | RFL9702HF |
| Product Overview : | Recombinant Full Length Human Tumor necrosis factor ligand superfamily member 9(TNFSF9) Protein (P41273) (1-254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-254) |
| Form : | Lyophilized powder |
| AA Sequence : | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | TNFSF9 |
| Synonyms | 4 1BB L; 4 1BB ligand; 4 1BBL; 4-1BB ligand; 4-1BBL; Cd137l; Cd157l; Homolog of mouse 4 1BB L; Homolog of mouse 4 1BBL; ILA ligand (TNF related); Ly63l; Receptor 4 1BB ligand; TNF superfamily member 9; TNFL9_HUMAN; Tnfsf9; TNLG5A; Tumor necrosis factor (l |
| UniProt ID | P41273 |
| ◆ Recombinant Proteins | ||
| TNFSF9-5242H | Recombinant Human TNFSF9 protein, His-tagged | +Inquiry |
| 4-1BB-L-516H | Active Recombinant Human TNFSF9 | +Inquiry |
| Tnfsf9-88M | Active Recombinant Mouse Tnfsf9 Protein (Arg104-Glu309), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| TNFSF9-102C | Recombinant Cynomolgus TNFSF9 protein, hFc-tagged | +Inquiry |
| Tnfsf9-5432M | Recombinant Mouse Tnfsf9 Protein (Arg104-Glu309), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF9-1444RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
| TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
| TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF9 Products
Required fields are marked with *
My Review for All TNFSF9 Products
Required fields are marked with *



