Recombinant Full Length Human TYROBP Protein, C-Flag-tagged
Cat.No. : | TYROBP-1569HFL |
Product Overview : | Recombinant Full Length Human TYROBP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 9.3 kDa |
AA Sequence : | MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Natural killer cell mediated cytotoxicity |
Full Length : | Full L. |
Gene Name | TYROBP transmembrane immune signaling adaptor TYROBP [ Homo sapiens (human) ] |
Official Symbol | TYROBP |
Synonyms | DAP12; KARAP; PLOSL; PLOSL1 |
Gene ID | 7305 |
mRNA Refseq | NM_003332.4 |
Protein Refseq | NP_003323.1 |
MIM | 604142 |
UniProt ID | O43914 |
◆ Recombinant Proteins | ||
TYROBP-5873Z | Recombinant Zebrafish TYROBP | +Inquiry |
TYROBP-1569HFL | Recombinant Full Length Human TYROBP Protein, C-Flag-tagged | +Inquiry |
TYROBP-2287H | Recombinant Human TYROBP Protein, His (Fc)-Avi-tagged | +Inquiry |
TYROBP-6039R | Recombinant Rat TYROBP Protein, His (Fc)-Avi-tagged | +Inquiry |
TYROBP-5044R | Recombinant Rhesus monkey TYROBP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
TYROBP-614HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TYROBP Products
Required fields are marked with *
My Review for All TYROBP Products
Required fields are marked with *
0
Inquiry Basket