Recombinant Full Length Human UBA2 Protein, C-Flag-tagged
Cat.No. : | UBA2-1373HFL |
Product Overview : | Recombinant Full Length Human UBA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71 kDa |
AA Sequence : | MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGR SKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESG TAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDR ADPEAAWEPTEAEARARASNEDGDIKRISTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPV PLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPS AMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTIL ISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAE DAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNADVSEEERSRKRKLDEKENLSAKRSRIEQK EELDDVIALDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | UBA2 ubiquitin like modifier activating enzyme 2 [ Homo sapiens (human) ] |
Official Symbol | UBA2 |
Synonyms | ARX; SAE2; ACCES; HRIHFB2115 |
Gene ID | 10054 |
mRNA Refseq | NM_005499.3 |
Protein Refseq | NP_005490.1 |
MIM | 613295 |
UniProt ID | Q9UBT2 |
◆ Recombinant Proteins | ||
UBA2-520H | Recombinant Human UBA2 Protein, His-tagged | +Inquiry |
UBA2-253H | Recombinant Human UBA2, GST-tagged | +Inquiry |
UBA2-1373HFL | Recombinant Full Length Human UBA2 Protein, C-Flag-tagged | +Inquiry |
UBA2-12542Z | Recombinant Zebrafish UBA2 | +Inquiry |
UBA2-3515H | Recombinant Human UBA2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBA2-606HCL | Recombinant Human UBA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBA2 Products
Required fields are marked with *
My Review for All UBA2 Products
Required fields are marked with *
0
Inquiry Basket