Recombinant Full Length Human UCK2 Protein, C-Flag-tagged
Cat.No. : | UCK2-1663HFL |
Product Overview : | Recombinant Full Length Human UCK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | UCK2 uridine-cytidine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | UCK2 |
Synonyms | UK; UMPK; TSA903 |
Gene ID | 7371 |
mRNA Refseq | NM_012474.5 |
Protein Refseq | NP_036606.2 |
MIM | 609329 |
UniProt ID | Q9BZX2 |
◆ Recombinant Proteins | ||
UCK2-30101TH | Recombinant Full Length Human UCK2, C His-tagged | +Inquiry |
UCK2-3953C | Recombinant Chicken UCK2 | +Inquiry |
UCK2-2306H | Recombinant Human UCK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UCK2-3575H | Recombinant Full Length Human UCK2, N His-tagged | +Inquiry |
UCK2-930H | Recombinant Full Length Human Uridine-cytidine Kinase 2, C His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCK2-531HCL | Recombinant Human UCK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UCK2 Products
Required fields are marked with *
My Review for All UCK2 Products
Required fields are marked with *
0
Inquiry Basket