Recombinant Full Length Human UGDH Protein, C-Flag-tagged
Cat.No. : | UGDH-2072HFL |
Product Overview : | Recombinant Full Length Human UGDH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.8 kDa |
AA Sequence : | MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLF FSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESI RRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILT TNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKD VLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSS IYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNK KPKV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Amino sugar and nucleotide sugar metabolism, Ascorbate and aldarate metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Starch and sucrose metabolism |
Full Length : | Full L. |
Gene Name | UGDH UDP-glucose 6-dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | UGDH |
Synonyms | GDH; UGD; DEE84; EIEE84; UDPGDH; UDP-GlcDH |
Gene ID | 7358 |
mRNA Refseq | NM_003359.4 |
Protein Refseq | NP_003350.1 |
MIM | 603370 |
UniProt ID | O60701 |
◆ Recombinant Proteins | ||
UGDH-1953C | Recombinant Chicken UGDH | +Inquiry |
UGDH-2072HFL | Recombinant Full Length Human UGDH Protein, C-Flag-tagged | +Inquiry |
UGDH-9882M | Recombinant Mouse UGDH Protein, His (Fc)-Avi-tagged | +Inquiry |
Ugdh-6827M | Recombinant Mouse Ugdh Protein, Myc/DDK-tagged | +Inquiry |
UGDH-729H | Recombinant Full Length Human UDP-glucose 6-dehydrogenase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGDH-516HCL | Recombinant Human UGDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGDH Products
Required fields are marked with *
My Review for All UGDH Products
Required fields are marked with *
0
Inquiry Basket