Recombinant Full Length Human UTP6 Protein, C-Flag-tagged
Cat.No. : | UTP6-1739HFL |
Product Overview : | Recombinant Full Length Human UTP6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable snoRNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Located in chromosome and nucleolus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 70 kDa |
AA Sequence : | MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIRR RRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNK PALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENP DYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARR ELEIESQTEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKR LERTMTVFRKAHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFRDSGTMWQLKLQVLIESKSPD IAMLFEEAFVHLKPQVCLPLWISWAEWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGY KKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMDYMKEELNHPL GRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | UTP6 UTP6 small subunit processome component [ Homo sapiens (human) ] |
Official Symbol | UTP6 |
Synonyms | HCA66; C17orf40 |
Gene ID | 55813 |
mRNA Refseq | NM_018428.3 |
Protein Refseq | NP_060898.2 |
UniProt ID | Q9NYH9 |
◆ Recombinant Proteins | ||
UTP6-17958M | Recombinant Mouse UTP6 Protein | +Inquiry |
UTP6-9984M | Recombinant Mouse UTP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
UTP6-1739HFL | Recombinant Full Length Human UTP6 Protein, C-Flag-tagged | +Inquiry |
UTP6-5136R | Recombinant Rhesus monkey UTP6 Protein, His-tagged | +Inquiry |
UTP6-2330H | Recombinant Human UTP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UTP6-445HCL | Recombinant Human UTP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UTP6 Products
Required fields are marked with *
My Review for All UTP6 Products
Required fields are marked with *
0
Inquiry Basket