Recombinant Full Length Human V-Set And Transmembrane Domain-Containing Protein 1(Vstm1) Protein, His-Tagged
| Cat.No. : | RFL13768HF |
| Product Overview : | Recombinant Full Length Human V-set and transmembrane domain-containing protein 1(VSTM1) Protein (Q6UX27) (17-236aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (17-236) |
| Form : | Lyophilized powder |
| AA Sequence : | YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAE NEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTI FVAIFSCISILLLFLSVFIIYRCSQHSSSSEESTKRTSHSKLPEQEAAEADLSNMERVSL STADPQGVTYAELSTSALSEAASDTTQEPPGSHEYAALKV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | VSTM1 |
| Synonyms | VSTM1; UNQ3033/PRO9835; V-set and transmembrane domain-containing protein 1; Signal inhibitory receptor on leukocytes-1; SIRL-1 |
| UniProt ID | Q6UX27 |
| ◆ Recombinant Proteins | ||
| VSTM1-500H | Recombinant Human VSTM1 Protein, Fc-tagged | +Inquiry |
| VSTM1-5796H | Recombinant Human VSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| VSTM1-4294H | Recombinant Human VSTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| VSTM1-486H | Recombinant Human VSTM1 Protein, MYC/DDK-tagged | +Inquiry |
| VSTM1-501H | Recombinant Human VSTM1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VSTM1-1683HCL | Recombinant Human VSTM1 cell lysate | +Inquiry |
| VSTM1-1682HCL | Recombinant Human VSTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSTM1 Products
Required fields are marked with *
My Review for All VSTM1 Products
Required fields are marked with *



