Recombinant Human VSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VSTM1-5796H
Product Overview : VSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_940883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Isoform 1: Inhibitory immune receptor involved in the regulation of phagocytes.
Molecular Mass : 24.4 kDa
AA Sequence : MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHGSSSEESTKRTSHSKLPEXEAAEADLSNMERVSLSTADPQGVTYAELSTSALSEAASDTTQEPPGSHEYAALKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VSTM1 V-set and transmembrane domain containing 1 [ Homo sapiens (human) ]
Official Symbol VSTM1
Synonyms VSTM1; V-set and transmembrane domain containing 1; SIRL1; SIRL-1; UNQ3033; V-set and transmembrane domain-containing protein 1; LAIR homolog; OSCAR-like transcript-1; signal inhibitory receptor on leukocytes-1
Gene ID 284415
mRNA Refseq NM_198481
Protein Refseq NP_940883
MIM 616804
UniProt ID Q6UX27

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VSTM1 Products

Required fields are marked with *

My Review for All VSTM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon