Recombinant Human VSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | VSTM1-5796H |
Product Overview : | VSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_940883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Isoform 1: Inhibitory immune receptor involved in the regulation of phagocytes. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHGSSSEESTKRTSHSKLPEXEAAEADLSNMERVSLSTADPQGVTYAELSTSALSEAASDTTQEPPGSHEYAALKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | VSTM1 V-set and transmembrane domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | VSTM1 |
Synonyms | VSTM1; V-set and transmembrane domain containing 1; SIRL1; SIRL-1; UNQ3033; V-set and transmembrane domain-containing protein 1; LAIR homolog; OSCAR-like transcript-1; signal inhibitory receptor on leukocytes-1 |
Gene ID | 284415 |
mRNA Refseq | NM_198481 |
Protein Refseq | NP_940883 |
MIM | 616804 |
UniProt ID | Q6UX27 |
◆ Recombinant Proteins | ||
VSTM1-500H | Recombinant Human VSTM1 Protein, Fc-tagged | +Inquiry |
VSTM1-5796H | Recombinant Human VSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VSTM1-4294H | Recombinant Human VSTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSTM1-501H | Recombinant Human VSTM1 Protein, His-tagged | +Inquiry |
RFL13768HF | Recombinant Full Length Human V-Set And Transmembrane Domain-Containing Protein 1(Vstm1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSTM1-1683HCL | Recombinant Human VSTM1 cell lysate | +Inquiry |
VSTM1-1682HCL | Recombinant Human VSTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSTM1 Products
Required fields are marked with *
My Review for All VSTM1 Products
Required fields are marked with *