Recombinant Full Length Human VIPR2 Protein, C-Flag-tagged
Cat.No. : | VIPR2-2132HFL |
Product Overview : | Recombinant Full Length Human VIPR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.3 kDa |
AA Sequence : | MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGET VTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMS LATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQ YCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVP WWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIS ISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ FHRGSRAQSFLQTETSVI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, GPCR, Transmembrane |
Protein Pathways : | Neuroactive ligand-receptor interaction |
Full Length : | Full L. |
Gene Name | VIPR2 vasoactive intestinal peptide receptor 2 [ Homo sapiens (human) ] |
Official Symbol | VIPR2 |
Synonyms | VPAC2; VPAC2R; VIP-R-2; VPCAP2R; PACAP-R3; DUP7q36.3; PACAP-R-3; C16DUPq36.3 |
Gene ID | 7434 |
mRNA Refseq | NM_003382.5 |
Protein Refseq | NP_003373.2 |
MIM | 601970 |
UniProt ID | P41587 |
◆ Cell & Tissue Lysates | ||
VIPR2-001HCL | Recombinant Human VIPR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VIPR2 Products
Required fields are marked with *
My Review for All VIPR2 Products
Required fields are marked with *
0
Inquiry Basket