Recombinant Full Length Human Voltage-Dependent Calcium Channel Gamma-7 Subunit(Cacng7) Protein, His-Tagged

Cat.No. : RFL21645HF
Product Overview : Recombinant Full Length Human Voltage-dependent calcium channel gamma-7 subunit(CACNG7) Protein (P62955) (1-275aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Full Length (1-275)
Form : Lyophilized powder
AA Sequence : MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
Purity : Greater than 90% as determined by SDS-PAGE.
Applications : SDS-PAGE
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name CACNG7
Synonyms CACNG7; Voltage-dependent calcium channel gamma-7 subunit; Neuronal voltage-gated calcium channel gamma-7 subunit; Transmembrane AMPAR regulatory protein gamma-7; TARP gamma-7
UniProt ID P62955

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNG7 Products

Required fields are marked with *

My Review for All CACNG7 Products

Required fields are marked with *

0
cart-icon