Recombinant Full Length Human Voltage-Dependent Calcium Channel Gamma-7 Subunit(Cacng7) Protein, His-Tagged
Cat.No. : | RFL21645HF |
Product Overview : | Recombinant Full Length Human Voltage-dependent calcium channel gamma-7 subunit(CACNG7) Protein (P62955) (1-275aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-275) |
Form : | Lyophilized powder |
AA Sequence : | MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CACNG7 |
Synonyms | CACNG7; Voltage-dependent calcium channel gamma-7 subunit; Neuronal voltage-gated calcium channel gamma-7 subunit; Transmembrane AMPAR regulatory protein gamma-7; TARP gamma-7 |
UniProt ID | P62955 |
◆ Recombinant Proteins | ||
CACNG7-3026HF | Recombinant Full Length Human CACNG7 Protein, GST-tagged | +Inquiry |
CACNG7-10647H | Recombinant Human CACNG7, GST-tagged | +Inquiry |
CACNG7-1076R | Recombinant Rat CACNG7 Protein | +Inquiry |
CACNG7-740R | Recombinant Rat CACNG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL24813RF | Recombinant Full Length Rat Voltage-Dependent Calcium Channel Gamma-7 Subunit(Cacng7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACNG7-271HCL | Recombinant Human CACNG7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNG7 Products
Required fields are marked with *
My Review for All CACNG7 Products
Required fields are marked with *