Recombinant Full Length Human VPS50 Protein, GST-tagged

• Cat.No.: VPS50-2836HF
• Product Overview: Human VPS50 full-length ORF (NP_078829.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 327 amino acids
• Description: VPS50 (VPS50, EARP/GARPII Complex Subunit) is a Protein Coding gene.
• Molecular Mass: 63.7 kDa
• AA Sequence: MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGKEEFRELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEAYRDKLKQQQAAVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTVCSDLITIHISLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: VPS50 VPS50, EARP/GARPII complex subunit [ Homo sapiens (human) ]
• Official Symbol: VPS50
• Synonyms: VPS50; VPS50, EARP/GARPII complex subunit; CCDC132; coiled-coil domain containing 132; coiled-coil domain-containing protein 132; DKFZp313I2429; FLJ20097; KIAA1861; FLJ23581; MGC176659
• Gene ID: 55610
• mRNA Refseq: NM_001257998
• Protein Refseq: NP_001244927
• UniProt ID: Q96JG6