Recombinant Full Length Human VRK1 protein, His tagged
Cat.No. : | VRK1-12H |
Product Overview : | Recombinant Full Length Human VRK1 protein (1-396 aa) with His tag was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-396 aa |
Description : | This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. |
Form : | Lyophilized |
Molecular Mass : | 47 kDa |
AA Sequence : | MVHHHHHHHHHHMPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 50mM Tris, 300mM NaCl, pH 7.5, 5 % Trehalose, 5 % Manitol. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.65 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Gene Name | VRK1 VRK serine/threonine kinase 1 [ Homo sapiens (human) ] |
Official Symbol | VRK1 |
Synonyms | VRK1; vaccinia related kinase 1; serine/threonine-protein kinase VRK1; vaccinia-related kinase 1; vaccinia virus B1R-related kinase 1; PCH1; MGC117401; MGC138280; MGC142070 |
Gene ID | 7443 |
mRNA Refseq | NM_003384 |
Protein Refseq | NP_003375 |
MIM | 602168 |
UniProt ID | Q99986 |
◆ Recombinant Proteins | ||
VRK1-1306H | Recombinant Human VRK1 protein(Met1-Lys396) | +Inquiry |
VRK1-4989R | Recombinant Rhesus Macaque VRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VRK1-05H | Recombinant Human VRK1 Protein (Full Length), N-FLAG tagged | +Inquiry |
VRK1-2229M | Recombinant Mouse VRK1 Protein (1-140 aa), His-Myc-tagged | +Inquiry |
VRK1-9822HF | Active Recombinant Full Length Human VRK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VRK1-001HCL | Recombinant Human VRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VRK1 Products
Required fields are marked with *
My Review for All VRK1 Products
Required fields are marked with *