Recombinant Full Length Human VSTM2A Protein, C-Flag-tagged
Cat.No. : | VSTM2A-1435HFL |
Product Overview : | Recombinant Full Length Human VSTM2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable identical protein binding activity. Involved in several processes, including positive regulation of brown fat cell differentiation; positive regulation of lipid storage; and positive regulation of white fat cell proliferation. Predicted to be located in extracellular region. Predicted to be integral component of membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPED LDPGAEGAGAQVKLLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHK AQAYLKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQS GMETHFEPFILPLTNAPQKGQSYRVDRFMNGDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | VSTM2A V-set and transmembrane domain containing 2A [ Homo sapiens (human) ] |
Official Symbol | VSTM2A |
Synonyms | VSTM2 |
Gene ID | 222008 |
mRNA Refseq | NM_182546.4 |
Protein Refseq | NP_872352.2 |
UniProt ID | Q8TAG5 |
◆ Recombinant Proteins | ||
VSTM2A-167H | Recombinant Human VSTM2A Protein, HIS-tagged | +Inquiry |
VSTM2A-18398M | Recombinant Mouse VSTM2A Protein | +Inquiry |
VSTM2A-2348H | Recombinant Human VSTM2A Protein, His (Fc)-Avi-tagged | +Inquiry |
VSTM2A-1435HFL | Recombinant Full Length Human VSTM2A Protein, C-Flag-tagged | +Inquiry |
Vstm2a-6951M | Recombinant Mouse Vstm2a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSTM2A-377HCL | Recombinant Human VSTM2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSTM2A Products
Required fields are marked with *
My Review for All VSTM2A Products
Required fields are marked with *
0
Inquiry Basket