Recombinant Full Length Human WFDC2 Protein, C-Flag-tagged
Cat.No. : | WFDC2-649HFL |
Product Overview : | Recombinant Full Length Human WFDC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 10 kDa |
AA Sequence : | MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | WFDC2 WAP four-disulfide core domain 2 [ Homo sapiens (human) ] |
Official Symbol | WFDC2 |
Synonyms | HE4; WAP5; EDDM4; dJ461P17.6 |
Gene ID | 10406 |
mRNA Refseq | NM_006103.4 |
Protein Refseq | NP_006094.3 |
MIM | 617548 |
UniProt ID | Q14508 |
◆ Recombinant Proteins | ||
WFDC2-3983H | Recombinant Human WFDC2 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
WFDC2-361H | Recombinant Human WFDC2 Protein, MYC/DDK-tagged | +Inquiry |
WFDC2-281H | Recombinant Human WFDC2 Protein, His-tagged | +Inquiry |
WFDC2-3415H | Recombinant Human WFDC2 Protein (Met1-Phe124), C-His tagged | +Inquiry |
WFDC2-55H | Recombinant Human WFDC2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC2-2056HCL | Recombinant Human WFDC2 cell lysate | +Inquiry |
WFDC2-1266CCL | Recombinant Canine WFDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WFDC2 Products
Required fields are marked with *
My Review for All WFDC2 Products
Required fields are marked with *
0
Inquiry Basket