Recombinant Full Length Human WNK1 Protein, GST-tagged
Cat.No. : | WNK1-3807HF |
Product Overview : | Human HSN2 full-length ORF ( NP_998820.1, 1 a.a. - 434 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 434 amino acids |
Description : | This gene encodes a member of the WNK subfamily of serine/threonine protein kinases. The encoded protein may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with pseudohypoaldosteronism type II and hereditary sensory neuropathy type II. Alternatively spliced transcript variants encoding different isoforms have been described but the full-length nature of all of them has yet to be determined.[provided by RefSeq, May 2010] |
Molecular Mass : | 73.5 kDa |
AA Sequence : | MYELLVLFMLIQPQSMAHPCGGTPTYPESQIFFPTIHERPVSFSPPPTCPPKVAISQRRKSTSFLEAQTHHFQPLLRTVGQSLLPPGGSPTNWTPEAVVMLGTTASRVTGESCEIQVHPMFEPSQVYSDYRPGLVLPEEAHYFIPQEAVYVAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSSSVFEFPSGQAFLVGHLQNLRLDSGLGPGSPLSSISAPISTDATRLKFHPVFVPHSAPAVLTHNNESRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQEELPPQSVGLHGYLQPVTEEKHNYHAPELTVSVVEPIGQNWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAAAPFGSDVSMPFIHLPQTVLQESPLFFCFPQGTTSQQVLTASFSSGGSALHPQVIGKLPQLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | WNK1 WNK lysine deficient protein kinase 1 [ Homo sapiens (human) ] |
Official Symbol | WNK1 |
Synonyms | WNK1; WNK lysine deficient protein kinase 1; KDP; PSK; p65; HSN2; HSAN2; PRKWNK1; PPP1R167; serine/threonine-protein kinase WNK1; WNK lysine deficient protein kinase 1 isoform; erythrocyte 65 kDa protein; prostate-derived sterile 20-like kinase; protein kinase with no lysine 1; protein phosphatase 1, regulatory subunit 167; serine/threonine-protein kinase WNK1 1; serine/threonine-protein kinase WNK1 2; EC 2.7.11.1 |
Gene ID | 65125 |
mRNA Refseq | NM_001184985 |
Protein Refseq | NP_001171914 |
MIM | 605232 |
UniProt ID | Q9H4A3 |
◆ Recombinant Proteins | ||
WNK1-90H | Recombinant Human WNK1 protein, Flag-tagged, Biotinylated | +Inquiry |
WNK1-5099H | Recombinant Human WNK1 Protein, GST-tagged | +Inquiry |
WNK1-589H | Recombinant Human WNK1 Protein, His-tagged | +Inquiry |
WNK1-18560M | Recombinant Mouse WNK1 Protein | +Inquiry |
WNK1-3807HF | Recombinant Full Length Human WNK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNK1-1933HCL | Recombinant Human WNK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNK1 Products
Required fields are marked with *
My Review for All WNK1 Products
Required fields are marked with *
0
Inquiry Basket