Recombinant Full Length Human XRCC6 Protein, C-Flag-tagged
Cat.No. : | XRCC6-484HFL |
Product Overview : | Recombinant Full Length Human XRCC6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.7 kDa |
AA Sequence : | MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSV YISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSD YSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGG FDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKA LKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNL EALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Non-homologous end-joining |
Full Length : | Full L. |
Gene Name | XRCC6 X-ray repair cross complementing 6 [ Homo sapiens (human) ] |
Official Symbol | XRCC6 |
Synonyms | ML8; KU70; TLAA; CTC75; CTCBF; G22P1 |
Gene ID | 2547 |
mRNA Refseq | NM_001469.5 |
Protein Refseq | NP_001460.1 |
MIM | 152690 |
UniProt ID | P12956 |
◆ Recombinant Proteins | ||
XRCC6-1548H | Recombinant Human XRCC6 protein | +Inquiry |
XRCC6-2371H | Recombinant Human XRCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
XRCC6-5925H | Recombinant Human XRCC6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Xrcc6-7024M | Recombinant Mouse Xrcc6 Protein, Myc/DDK-tagged | +Inquiry |
Xrcc6-449R | Recombinant Rat Xrcc6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRCC6-253HCL | Recombinant Human XRCC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XRCC6 Products
Required fields are marked with *
My Review for All XRCC6 Products
Required fields are marked with *
0
Inquiry Basket