Recombinant Full Length Human YBX2 Protein, GST tagged

• Cat.No.: YBX2-03HFL
• Product Overview: Human YBX2 full-length ORF (NP_057066.1, 1-364 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat germ cell free in vitro.

Specification

• Species: Human
• Source: Wheat germ cell free in vitro
• Tag: GST
• Protein Length: 1-364 aa
• Description: This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are located on chromosome 10 and 15.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 65 kDa
• AASequence: MSEVEAAAVATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
• Applications: Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Information

• Gene Name: YBX2 Y-box binding protein 2 [ Homo sapiens (human) ]
• Official Symbol: YBX2
• Synonyms: YBX2; Y-box binding protein 2; DBPC; MSY2; CSDA3; CONTRIN; Y-box-binding protein 2; DNA-binding protein C; alternative protein YBX2; epididymis secretory sperm binding protein; germ cell specific Y-box binding protein
• Gene ID: 51087
• mRNA Refseq: NM_015982
• Protein Refseq: NP_057066
• MIM: 611447
• UniProt ID: Q9Y2T7