Recombinant Full Length Human YES1 Protein, C-Flag-tagged
Cat.No. : | YES1-1102HFL |
Product Overview : | Recombinant Full Length Human YES1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.6 kDa |
AA Sequence : | MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTP FGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNG YIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVK HYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLE VKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEF MSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYR MPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Adherens junction, Tight junction |
Full Length : | Full L. |
Gene Name | YES1 YES proto-oncogene 1, Src family tyrosine kinase [ Homo sapiens (human) ] |
Official Symbol | YES1 |
Synonyms | Yes; c-yes; HsT441; P61-YES |
Gene ID | 7525 |
mRNA Refseq | NM_005433.4 |
Protein Refseq | NP_005424.1 |
MIM | 164880 |
UniProt ID | P07947 |
◆ Recombinant Proteins | ||
YES1-0737H | Recombinant Human YES1 Protein (G2-L543), Tag Free | +Inquiry |
YES1-1509H | Active Recombinant Human YES1, GST-tagged | +Inquiry |
YES1-3765H | Recombinant Human YES1, His-tagged | +Inquiry |
YES1-237H | Recombinant Human YES1, UD Domain | +Inquiry |
YES1-159H | Recombinant Human YES1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YES1-620HCL | Recombinant Human YES1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YES1 Products
Required fields are marked with *
My Review for All YES1 Products
Required fields are marked with *
0
Inquiry Basket