Recombinant Full Length Human YJU2 Protein, C-Flag-tagged
| Cat.No. : | YJU2-1727HFL |
| Product Overview : | Recombinant Full Length Human YJU2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable metal ion binding activity. Predicted to be involved in RNA splicing and negative regulation of DNA damage response, signal transduction by p53 class mediator. Part of U2-type catalytic step 1 spliceosome. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 36.9 kDa |
| AA Sequence : | MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEVYLG LPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENR TKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEEARKRRLLED SDSEDEAAPSPLQPALRPNPTAILDEAPKPKRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADPDCSNGQP QAAPTPGAPQNRKEANPTPLTPGASSLSQLGAYLDSDDSNGSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | YJU2 YJU2 splicing factor homolog [ Homo sapiens (human) ] |
| Official Symbol | YJU2 |
| Synonyms | CCDC94 |
| Gene ID | 55702 |
| mRNA Refseq | NM_018074.6 |
| Protein Refseq | NP_060544.2 |
| UniProt ID | Q9BW85 |
| ◆ Recombinant Proteins | ||
| Yju2-7034M | Recombinant Mouse Yju2 Protein, Myc/DDK-tagged | +Inquiry |
| YJU2-1727HFL | Recombinant Full Length Human YJU2 Protein, C-Flag-tagged | +Inquiry |
| YJU2-2375H | Recombinant Human YJU2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| YJU2-2654H | Recombinant Human YJU2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YJU2 Products
Required fields are marked with *
My Review for All YJU2 Products
Required fields are marked with *
