Recombinant Full Length Human YWHAB Protein, C-Flag-tagged
Cat.No. : | YWHAB-1874HFL |
Product Overview : | Recombinant Full Length Human YWHAB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.9 kDa |
AA Sequence : | MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK TERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Full Length : | Full L. |
Gene Name | YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [ Homo sapiens (human) ] |
Official Symbol | YWHAB |
Synonyms | HS1; GW128; YWHAA; KCIP-1; HEL-S-1 |
Gene ID | 7529 |
mRNA Refseq | NM_003404.5 |
Protein Refseq | NP_003395.1 |
MIM | 601289 |
UniProt ID | P31946 |
◆ Recombinant Proteins | ||
YWHAB-4895H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Beta Polypeptide | +Inquiry |
YWHAB-3774H | Recombinant Human YWHAB, GST-tagged | +Inquiry |
YWHAB-26000TH | Recombinant Human YWHAB | +Inquiry |
Ywhab-5820M | Recombinant Mouse Ywhab protein, His-sumostar-tagged | +Inquiry |
Ywhab-7039M | Recombinant Mouse Ywhab Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAB-233HCL | Recombinant Human YWHAB 293 Cell Lysate | +Inquiry |
YWHAB-234HCL | Recombinant Human YWHAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YWHAB Products
Required fields are marked with *
My Review for All YWHAB Products
Required fields are marked with *
0
Inquiry Basket