Recombinant Full Length Human YWHAH Protein, C-Flag-tagged
| Cat.No. : | YWHAH-922HFL |
| Product Overview : | Recombinant Full Length Human YWHAH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 28 kDa |
| AA Sequence : | MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transcription Factors |
| Protein Pathways : | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
| Full Length : | Full L. |
| Gene Name | YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta [ Homo sapiens (human) ] |
| Official Symbol | YWHAH |
| Synonyms | YWHA1 |
| Gene ID | 7533 |
| mRNA Refseq | NM_003405.4 |
| Protein Refseq | NP_003396.1 |
| MIM | 113508 |
| UniProt ID | Q04917 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAH Products
Required fields are marked with *
My Review for All YWHAH Products
Required fields are marked with *
Recently Viewed
