Recombinant Full Length Human ZFYVE21 Protein, C-Flag-tagged
| Cat.No. : | ZFYVE21-584HFL |
| Product Overview : | Recombinant Full Length Human ZFYVE21 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 26.3 kDa |
| AA Sequence : | MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG RRQAVAWLVAMHKAAKLLYESRDQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | ZFYVE21 zinc finger FYVE-type containing 21 [ Homo sapiens (human) ] |
| Official Symbol | ZFYVE21 |
| Synonyms | ZF21; HCVP7TP1 |
| Gene ID | 79038 |
| mRNA Refseq | NM_024071.4 |
| Protein Refseq | NP_076976.1 |
| MIM | 613504 |
| UniProt ID | Q9BQ24 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZFYVE21 Products
Required fields are marked with *
My Review for All ZFYVE21 Products
Required fields are marked with *



