Recombinant Full Length Human ZFYVE21 Protein, C-Flag-tagged
Cat.No. : | ZFYVE21-584HFL |
Product Overview : | Recombinant Full Length Human ZFYVE21 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG RRQAVAWLVAMHKAAKLLYESRDQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ZFYVE21 zinc finger FYVE-type containing 21 [ Homo sapiens (human) ] |
Official Symbol | ZFYVE21 |
Synonyms | ZF21; HCVP7TP1 |
Gene ID | 79038 |
mRNA Refseq | NM_024071.4 |
Protein Refseq | NP_076976.1 |
MIM | 613504 |
UniProt ID | Q9BQ24 |
◆ Recombinant Proteins | ||
ZFYVE21-7476Z | Recombinant Zebrafish ZFYVE21 | +Inquiry |
ZFYVE21-19166M | Recombinant Mouse ZFYVE21 Protein | +Inquiry |
ZFYVE21-10371M | Recombinant Mouse ZFYVE21 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZFYVE21-1628H | Recombinant Human ZFYVE21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZFYVE21-4911C | Recombinant Chicken ZFYVE21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFYVE21-174HCL | Recombinant Human ZFYVE21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZFYVE21 Products
Required fields are marked with *
My Review for All ZFYVE21 Products
Required fields are marked with *
0
Inquiry Basket