Recombinant Full Length Human ZG16 Protein, GST-tagged
Cat.No. : | ZG16-5919HF |
Product Overview : | Human LOC653808 full-length ORF (BAG54214.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 167 amino acids |
Description : | ZG16 (Zymogen Granule Protein 16) is a Protein Coding gene. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is ZG16B. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ZG16 zymogen granule protein 16 [ Homo sapiens (human) ] |
Official Symbol | ZG16 |
Synonyms | ZG16; zymogen granule protein 16; JCLN; JCLN1; ZG16A; FLJ43571; FLJ92276; MGC34820; MGC183567; zymogen granule membrane protein 16; jacalin-like lectin domain containing; secretory lectin ZG16; zymogen granule protein 16 homolog |
Gene ID | 653808 |
mRNA Refseq | NM_152338 |
Protein Refseq | NP_689551 |
MIM | 617311 |
UniProt ID | O60844 |
◆ Recombinant Proteins | ||
ZG16-202H | Recombinant Human ZG16, His-tagged | +Inquiry |
ZG16-522H | Recombinant Human zymogen granule protein 16, His-tagged | +Inquiry |
ZG16-5123H | Recombinant Human ZG16, His-tagged | +Inquiry |
ZG16-562H | Recombinant Human ZG16 protein, His-tagged | +Inquiry |
ZG16-6704R | Recombinant Rat ZG16 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZG16-171HCL | Recombinant Human ZG16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZG16 Products
Required fields are marked with *
My Review for All ZG16 Products
Required fields are marked with *