Recombinant Full Length Macaca Fascicularis 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 2(Srd5A2) Protein, His-Tagged
| Cat.No. : | RFL34267MF |
| Product Overview : | Recombinant Full Length Macaca fascicularis 3-oxo-5-alpha-steroid 4-dehydrogenase 2(SRD5A2) Protein (Q28892) (1-254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca fascicularis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-254) |
| Form : | Lyophilized powder |
| AA Sequence : | MQVQCQQSPVLAGSATLVALGALVLYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS FAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAVLIFRGIAFCA GNGFLQSYYLIYCAEYPDGWYTDIRFCLGVFLFILGMGVNIHSDYILRQLRKPGEITYRI PKGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSVCFLGLRAFHHHRFYLKMFE DYPKSRKALIPFIF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SRD5A2 |
| Synonyms | SRD5A2; 3-oxo-5-alpha-steroid 4-dehydrogenase 2; 5 alpha-SR2; SR type 2; Steroid 5-alpha-reductase 2; S5AR 2 |
| UniProt ID | Q28892 |
| ◆ Recombinant Proteins | ||
| SRD5A2-655HF | Recombinant Full Length Human SRD5A2 Protein | +Inquiry |
| SRD5A2-717C | Recombinant Cynomolgus Monkey SRD5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL10292RF | Recombinant Full Length Rat 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 2(Srd5A2) Protein, His-Tagged | +Inquiry |
| SRD5A2-4144H | Recombinant Human SRD5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRD5A2-5735R | Recombinant Rat SRD5A2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRD5A2-1480HCL | Recombinant Human SRD5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRD5A2 Products
Required fields are marked with *
My Review for All SRD5A2 Products
Required fields are marked with *
