Recombinant Full Length Macaca Fascicularis Free Fatty Acid Receptor 1(Ffar1) Protein, His-Tagged
Cat.No. : | RFL6650MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Free fatty acid receptor 1(FFAR1) Protein (Q76JV1) (1-300aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-300) |
Form : | Lyophilized powder |
AA Sequence : | MDLPPQLSFALYVAAFALGFPLNVLAIRGARAHARRRLTPSLVYALNLGCSDLLLTVSLP LKAVEALASGAWPLPASLCPVFGVAHFAPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP CYSWGVCAAIWALVLCHLGLVFVLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG PARFSLSLLLFFLPLAITAFCYVGCLRALAHSGLTHRRKLRAAWVAGGALLTLLLCVGPY NASNVASFLNPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGSTSQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FFAR1 |
Synonyms | FFAR1; GPR40; Free fatty acid receptor 1; G-protein coupled receptor 40 |
UniProt ID | Q76JV1 |
◆ Recombinant Proteins | ||
FFAR1-3217M | Recombinant Mouse FFAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FFAR1-12852H | Recombinant Human FFAR1, GST-tagged | +Inquiry |
FFAR1-1040HFL | Recombinant Human FFAR1 protein, His&Flag-tagged | +Inquiry |
RFL6650MF | Recombinant Full Length Macaca Fascicularis Free Fatty Acid Receptor 1(Ffar1) Protein, His-Tagged | +Inquiry |
FFAR1-8754H | Active Recombinant Human FFAR1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FFAR1-6257HCL | Recombinant Human FFAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FFAR1 Products
Required fields are marked with *
My Review for All FFAR1 Products
Required fields are marked with *