Recombinant Full Length Macaca Fascicularis Long-Chain Fatty Acid Transport Protein 4(Slc27A4) Protein, His-Tagged
Cat.No. : | RFL29445MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Long-chain fatty acid transport protein 4(SLC27A4) Protein (Q4R3Y4) (1-643aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-643) |
Form : | Lyophilized powder |
AA Sequence : | MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL KVKAKVRQCLRERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQA RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG SEMASAICEIHASLDPSLSLFCSGSWEPNAVPTSTEHLDPLLEDAPKHLPSCPDKGFTDK LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIIYDCLPLYHSAGNIVGIGQ CLLHGMTVVIRKKFSASRFWDDCIKYKCTIVQYIGELCRYLLNQPPREAENQHQVRMALG NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR VNEDTMELIRGPDGICIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKK GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE VPGTEGRAGMAAVASPTGNCDLERFAQDLEKELPLYARPIFLRILPELHKTGTYKLQKTE LRKEGFDPAIVKDPLFYLDARKGRYVPLDQEAYSRIQAGEEKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC27A4 |
Synonyms | SLC27A4; FATP4; QtsA-13277; Long-chain fatty acid transport protein 4; FATP-4; Fatty acid transport protein 4; Arachidonate--CoA ligase; Long-chain-fatty-acid--CoA ligase; Solute carrier family 27 member 4; Very long-chain acyl-CoA synthetase 4; ACSVL4 |
UniProt ID | Q4R3Y4 |
◆ Recombinant Proteins | ||
SLC27A4-672C | Recombinant Cynomolgus Monkey SLC27A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC27A4-0605H | Recombinant Human SLC27A4 Protein (L2-L643), 8×His-MBP, Flag tagged | +Inquiry |
SLC27A4-5580H | Recombinant Human SLC27A4 Protein (Met1-Phe237), N-His tagged | +Inquiry |
RFL29445MF | Recombinant Full Length Macaca Fascicularis Long-Chain Fatty Acid Transport Protein 4(Slc27A4) Protein, His-Tagged | +Inquiry |
SLC27A4-394H | Recombinant Human SLC27A4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC27A4-001HCL | Recombinant Human SLC27A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC27A4 Products
Required fields are marked with *
My Review for All SLC27A4 Products
Required fields are marked with *
0
Inquiry Basket