Recombinant Full Length Macaca Fascicularis Nkg2-D Type Ii Integral Membrane Protein(Klrk1) Protein, His-Tagged
| Cat.No. : | RFL32395MF |
| Product Overview : | Recombinant Full Length Macaca fascicularis NKG2-D type II integral membrane protein(KLRK1) Protein (P61252) (1-216aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca fascicularis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-216) |
| Form : | Lyophilized powder |
| AA Sequence : | MGWIRGRRPRHNLEMSEFHNYKLGLAKSDFSTRCQKQRCPVIKSKCRENASPLFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | KLRK1 |
| Synonyms | KLRK1; NKG2D; NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD antigen CD314 |
| UniProt ID | P61252 |
| ◆ Recombinant Proteins | ||
| KLRK1-114H | Recombinant Human KLRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KLRK1-215H | Recombinant Human KLRK1 Protein, hIgG-His-tagged | +Inquiry |
| KLRK1-8537H | Recombinant Human KLRK1 protein(Phe78-Val216), His-tagged | +Inquiry |
| KLRK1-2956R | Recombinant Rat KLRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Klrk1-1720M | Recombinant Mouse Klrk1(Phe94 - Val232) Protein, N-Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLRK1-001HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
| KLRK1-001CCL | Recombinant Cynomolgus KLRK1 cell lysate | +Inquiry |
| KLRK1-002HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRK1 Products
Required fields are marked with *
My Review for All KLRK1 Products
Required fields are marked with *
