Recombinant Full Length Macaca Fascicularis Nkg2-D Type Ii Integral Membrane Protein(Klrk1) Protein, His-Tagged
Cat.No. : | RFL32395MF |
Product Overview : | Recombinant Full Length Macaca fascicularis NKG2-D type II integral membrane protein(KLRK1) Protein (P61252) (1-216aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-216) |
Form : | Lyophilized powder |
AA Sequence : | MGWIRGRRPRHNLEMSEFHNYKLGLAKSDFSTRCQKQRCPVIKSKCRENASPLFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KLRK1 |
Synonyms | KLRK1; NKG2D; NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD antigen CD314 |
UniProt ID | P61252 |
◆ Recombinant Proteins | ||
KLRK1-2956R | Recombinant Rat KLRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRK1-1533C | Recombinant Cynomolgus KLRK1 protein, His-tagged | +Inquiry |
KLRK1-114H | Recombinant Human KLRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Klrk1-4543M | Recombinant Mouse Klrk1 protein, hFc-tagged | +Inquiry |
KLRK1-5776HF | Recombinant Full Length Human KLRK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRK1-002HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
KLRK1-001HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
KLRK1-001CCL | Recombinant Cynomolgus KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRK1 Products
Required fields are marked with *
My Review for All KLRK1 Products
Required fields are marked with *
0
Inquiry Basket