Recombinant Full Length Macaca Fascicularis T-Cell Immunomodulatory Protein(Itfg1) Protein, His-Tagged
| Cat.No. : | RFL32307MF |
| Product Overview : | Recombinant Full Length Macaca fascicularis T-cell immunomodulatory protein(ITFG1) Protein (Q95KC8) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca fascicularis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-311) |
| Form : | Lyophilized powder |
| AA Sequence : | PVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKNTSGSNQQA FLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYTK NDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLK NGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQ LIVIPYPHNVPRSWSAKLYLTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKR QEAHRFHFDAM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ITFG1 |
| Synonyms | ITFG1; LNKN-1; TIP; QmoA-10172; T-cell immunomodulatory protein; Protein TIP; Integrin-alpha FG-GAP repeat-containing protein 1; Linkin; Fragment |
| UniProt ID | Q95KC8 |
| ◆ Recombinant Proteins | ||
| RFL29694HF | Recombinant Full Length Human T-Cell Immunomodulatory Protein(Itfg1) Protein, His-Tagged | +Inquiry |
| RFL34344RF | Recombinant Full Length Rat T-Cell Immunomodulatory Protein(Itfg1) Protein, His-Tagged | +Inquiry |
| ITFG1-174H | Recombinant Human ITFG1 protein, His/T7-tagged | +Inquiry |
| ITFG1-5666HF | Recombinant Full Length Human ITFG1 Protein, GST-tagged | +Inquiry |
| ITFG1-8342M | Recombinant Mouse ITFG1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITFG1-5140HCL | Recombinant Human ITFG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITFG1 Products
Required fields are marked with *
My Review for All ITFG1 Products
Required fields are marked with *
