Recombinant Full Length Macaca Fuscata Fuscata Glycophorin-A(Gypa) Protein, His-Tagged
Cat.No. : | RFL27503MF |
Product Overview : | Recombinant Full Length Macaca fuscata fuscata Glycophorin-A(GYPA) Protein (P14221) (1-144aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fuscata fuscata (Japanese macaque) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-144) |
Form : | Lyophilized powder |
AA Sequence : | SSTTVPATHTSSSSLGPEQYVSSQSNDKHTSDSHPTPTSAHEVTTEFSGRTHYPPEEDDR VQLVHEFSELVIALIIFGVMAGVIGTILFISYGSRRLIKKSESDVQPLPPPDAEVPLSSV EIEDPEETDELNSFTKPNQERNES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GYPA |
Synonyms | GYPA; Glycophorin-A; Glycophorin-MK; CD antigen CD235a |
UniProt ID | P14221 |
◆ Recombinant Proteins | ||
GYPA-3008H | Recombinant Human GYPA protein, His-tagged | +Inquiry |
GYPA-29030TH | Recombinant Human GYPA | +Inquiry |
GYPA-056H | Recombinant Human GYPA Protein, His-tagged | +Inquiry |
Gypa-267M | Recombinant Mouse Gypa Protein, His and Fc-tagged | +Inquiry |
RFL23215SF | Recombinant Full Length Pig Glycophorin-A(Gypa) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYPA-749HCL | Recombinant Human GYPA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GYPA Products
Required fields are marked with *
My Review for All GYPA Products
Required fields are marked with *