Recombinant Full Length Macaca Mulatta (Rhesus Macaque) 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 1(Hsd3B1) Protein, His-Tagged
| Cat.No. : | RFL12014MF |
| Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1(HSD3B1) Protein (P27365) (2-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca mulatta |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-373) |
| Form : | Lyophilized powder |
| AA Sequence : | TGWSCLVTGAGGFLGQRIVRLLVEEKELKEIRVLDKAFRPELREEFSKLQNKTKLTVLEG DILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI YTSTLEVAGPNSYKEIIQNGHEEEPLENTWPAPYPYSKKLAEKAVLAANGWTLKNGGTLY TCALRPMYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR DPKKAPSVQGQFYYISDDTPHQSYDNLNYILSKEFGLCLDSRWSLPLALMYWIGFLLEVV SFLLSPVYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV DRHKETLKSKTQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | HSD3B1 |
| Synonyms | HSD3B1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydr |
| UniProt ID | P27365 |
| ◆ Recombinant Proteins | ||
| RFL6400MF | Recombinant Full Length Mesocricetus Auratus 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 1(Hsd3B1) Protein, His-Tagged | +Inquiry |
| HSD3B1-2933R | Recombinant Rat HSD3B1 Protein | +Inquiry |
| HSD3B1-12064Z | Recombinant Zebrafish HSD3B1 | +Inquiry |
| HSD3B1-22H | Recombinant Human HSD3B1 protein, Myc/DDK-tagged | +Inquiry |
| Hsd3b1-1182M | Recombinant Mouse Hsd3b1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD3B1-5370HCL | Recombinant Human HSD3B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD3B1 Products
Required fields are marked with *
My Review for All HSD3B1 Products
Required fields are marked with *
