Recombinant Full Length Macaca Mulatta (Rhesus Macaque) C-C Chemokine Receptor Type 1(Ccr1) Protein, His-Tagged
Cat.No. : | RFL33798MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 1(CCR1) Protein (P56482) (1-355aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-355) |
Form : | Lyophilized powder |
AA Sequence : | METPNTTEDYDMITEFDYGDATPCHKVNERAILAQLLPPLYSLVFVIGVVGNLLVVLVLV QYKRLKNMTNIYLLNLAISDLLFLFTLPFLIYYKSTDDWIFGDAMCKILSGFYYTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASSPLMYFSKTQWNIVR HSCNIHFPYESFQQWKLFQALKLNLFGLVLPLLVMIVCYTGIIKILLRRPNEKKSKAVRL IFVIMIIFFLFWTPYNLTELISVFQEFLFTHLCEQNRQLDLAMEVTEVIANMHCCVNPVI YAFAGERFRKYLRQLFHRRVAVHLVKWLPFLSGDRLERVSSTSPSTGEHELSAGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCR1 |
Synonyms | CCR1; CMKBR1; C-C chemokine receptor type 1; C-C CKR-1; CC-CKR-1; CCR-1; CCR1; CD antigen CD191 |
UniProt ID | P56482 |
◆ Recombinant Proteins | ||
CCR1-1419M | Recombinant Mouse CCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCR1-6213H | Recombinant Human CCR1 protein, His-SUMO-tagged | +Inquiry |
CCR1-704R | Recombinant Rhesus monkey CCR1 Protein, His-tagged | +Inquiry |
CCR1-2997HF | Recombinant Full Length Human CCR1 Protein | +Inquiry |
CCR1-0686H | Recombinant Human CCR1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR1-7698HCL | Recombinant Human CCR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR1 Products
Required fields are marked with *
My Review for All CCR1 Products
Required fields are marked with *
0
Inquiry Basket