Recombinant Full Length Macaca Nemestrina G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged
Cat.No. : | RFL24998MF |
Product Overview : | Recombinant Full Length Macaca nemestrina G-protein coupled receptor 15(GPR15) Protein (P56412) (1-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca nemestrina |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-360) |
Form : | Lyophilized powder |
AA Sequence : | MDPEETSVYLDYYYATSPNPDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS VFLLTCMSVDRYLAIVCPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK PYCAEKKATPLKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI KIIFIVVAAFLVSWLPFNTSKLLAIVSGLQQERYFPSAILQLGMEVSGPLAFANSCVNPF IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFTRRRKRSVSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR15 |
Synonyms | GPR15; G-protein coupled receptor 15 |
UniProt ID | P56412 |
◆ Recombinant Proteins | ||
EIF1B-5073M | Recombinant Mouse EIF1B Protein | +Inquiry |
EIF1B-5161HF | Recombinant Full Length Human EIF1B Protein, GST-tagged | +Inquiry |
RFL21694HF | Recombinant Full Length Human G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
GPR15-307C | Recombinant Cynomolgus Monkey GPR15 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF1B-3480H | Recombinant Human EIF1B, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *
0
Inquiry Basket