Recombinant Full Length Meriones Unguiculatus Substance-P Receptor(Tacr1) Protein, His-Tagged
Cat.No. : | RFL1186MF |
Product Overview : | Recombinant Full Length Meriones unguiculatus Substance-P receptor(TACR1) Protein (Q5DUB1) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meriones unguiculatus (Mongolian jird) (Mongolian gerbil) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MDNVLPGDSDLFPNISTNSSESNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPGRVVC MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYVKKFIQQVYLAIMWLAMSSTMY NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST VVGAHEDEAEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TACR1 |
Synonyms | TACR1; Substance-P receptor; SPR; NK-1 receptor; NK-1R; Tachykinin receptor 1 |
UniProt ID | Q5DUB1 |
◆ Recombinant Proteins | ||
TACR1-1267H | Recombinant Human TACR1 Protein (M1-S226, H237-E335, E78N, Y121W, T222R), Flag-10×His tagged | +Inquiry |
TACR1-128H | Recombinant Human TACR1 protein, GST-tagged | +Inquiry |
RFL8485CF | Recombinant Full Length Guinea Pig Substance-P Receptor(Tacr1) Protein, His-Tagged | +Inquiry |
TACR1-2748H | Recombinant Human TACR1 Protein, His-tagged | +Inquiry |
TACR1-5906R | Recombinant Rat TACR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TACR1-1283HCL | Recombinant Human TACR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TACR1 Products
Required fields are marked with *
My Review for All TACR1 Products
Required fields are marked with *
0
Inquiry Basket