Recombinant Full Length Mouse 3-Keto-Steroid Reductase(Hsd17B7) Protein, His-Tagged
Cat.No. : | RFL2090MF |
Product Overview : | Recombinant Full Length Mouse 3-keto-steroid reductase(Hsd17b7) Protein (O88736) (1-334aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-334) |
Form : | Lyophilized powder |
AA Sequence : | MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hsd17b7 |
Synonyms | Hsd17b7; 17hsd7; 3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7; 17-beta-hydroxysteroid dehydrogenase 7; 17-beta-HSD 7; 3-keto-steroid reductase; Dihydrotestosterone oxidoreductase; Estradiol 17-beta-dehydrogenase 7 |
UniProt ID | O88736 |
◆ Recombinant Proteins | ||
HSD17B7-1108H | Recombinant Human HSD17B7 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B7-602C | Recombinant Cynomolgus HSD17B7 Protein, His-tagged | +Inquiry |
HSD17B7-3873HF | Recombinant Full Length Human HSD17B7 Protein, GST-tagged | +Inquiry |
HSD17B7-4686Z | Recombinant Zebrafish HSD17B7 | +Inquiry |
RFL8642HF | Recombinant Full Length Human 3-Keto-Steroid Reductase(Hsd17B7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B7-819HCL | Recombinant Human HSD17B7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hsd17b7 Products
Required fields are marked with *
My Review for All Hsd17b7 Products
Required fields are marked with *