Recombinant Full Length Mouse Activin Receptor Type-1(Acvr1) Protein, His-Tagged
Cat.No. : | RFL-27610MF |
Product Overview : | Recombinant Full Length Mouse Activin receptor type-1(Acvr1) Protein (P37172) (21-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-509) |
Form : | Lyophilized powder |
AA Sequence : | VEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Acvr1 |
Synonyms | Acvr1; Acvrlk2; Tgfb1; Activin receptor type-1; Activin receptor type I; ACTR-I; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I; TSK-7L |
UniProt ID | P37172 |
◆ Recombinant Proteins | ||
ACVR1-5680H | Recombinant Human ACVR1 protein, His-tagged | +Inquiry |
ACVR1-161C | Recombinant Canine ACVR1, His-tagged | +Inquiry |
Acvr1-5682M | Recombinant Mouse Acvr1 protein, His-tagged | +Inquiry |
ACVR1-0158H | Recombinant Human ACVR1 Protein (T172-C509), Tag Free | +Inquiry |
ACVR1-201H | Active Recombinant Human ACVR1(R206H), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
ACVR1-1232CCL | Recombinant Cynomolgus ACVR1 cell lysate | +Inquiry |
ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-967CCL | Recombinant Canine ACVR1 cell lysate | +Inquiry |
ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Acvr1 Products
Required fields are marked with *
My Review for All Acvr1 Products
Required fields are marked with *