Recombinant Full Length Mouse Adp/Atp Translocase 4(Slc25A31) Protein, His-Tagged
Cat.No. : | RFL29999MF |
Product Overview : | Recombinant Full Length Mouse ADP/ATP translocase 4(Slc25a31) Protein (Q3V132) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MSNESSKKQSSKKALFDPVSFSKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISP EARYKGMLDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKELFMSGVNKEK QFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEQRQFTGLGDCIMKIAKS DGLIGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLVSFIIAQIVTTCSGIL SYPFDTVRRRMMMQSGESDRQYKGTIDCFLKIYRHEGVPAFFRGAFSNILRGTGGALVLV LYDKIKEFLNIDVGGSSSGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc25a31 |
Synonyms | Slc25a31; Aac4; Ant4; Sfec; ADP/ATP translocase 4; ADP,ATP carrier protein 4; Adenine nucleotide translocator 4; ANT 4; Solute carrier family 25 member 31; Sperm flagellar energy carrier protein |
UniProt ID | Q3V132 |
◆ Recombinant Proteins | ||
SLC25A31-4253R | Recombinant Rhesus monkey SLC25A31 Protein, His-tagged | +Inquiry |
SLC25A31-158H | Recombinant Human SLC25A31 Protein, His-tagged | +Inquiry |
RFL35385MF | Recombinant Full Length Macaca Fascicularis Adp/Atp Translocase 4(Slc25A31) Protein, His-Tagged | +Inquiry |
SLC25A31-927C | Recombinant Cynomolgus SLC25A31 Protein, His-tagged | +Inquiry |
SLC25A31-670C | Recombinant Cynomolgus Monkey SLC25A31 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A31-1769HCL | Recombinant Human SLC25A31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc25a31 Products
Required fields are marked with *
My Review for All Slc25a31 Products
Required fields are marked with *