Recombinant Full Length Mouse Adrenocorticotropic Hormone Receptor(Mc2R) Protein, His-Tagged
Cat.No. : | RFL29981MF |
Product Overview : | Recombinant Full Length Mouse Adrenocorticotropic hormone receptor(Mc2r) Protein (Q64326) (1-296aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-296) |
Form : | Lyophilized powder |
AA Sequence : | MKHIINSYEHTNDTARNNSDCPDVVLPEEIFFTISVIGILENLIVLLAVIKNKNLQSPMY FFICSLAISDMLGSLYKILENILIMFRNMGYLKPRGSFESTADDIIDCMFILSLLGSIFS LSVIAADRYITIFHALQYHSIVTMRRTIITLTIIWMFCTGSGITMVIFSHHIPTVLTFTS LFPLMLVFILCLYIHMFLLARSHARKISTLPRTNMKGAMTLTILLGVFIFCWAPFVLHVL LMTFCPNNPYCVCYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKRMLFCNRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mc2r |
Synonyms | Mc2r; Acthr; Adrenocorticotropic hormone receptor; ACTH receptor; ACTH-R; Adrenocorticotropin receptor; Melanocortin receptor 2; MC2-R |
UniProt ID | Q64326 |
◆ Recombinant Proteins | ||
MC2R-1483HFL | Recombinant Full Length Human MC2R Protein, C-Flag-tagged | +Inquiry |
MC2R-1379H | Recombinant Human MC2R Protein, His (Fc)-Avi-tagged | +Inquiry |
Mc2r-3986M | Recombinant Mouse Mc2r Protein, Myc/DDK-tagged | +Inquiry |
MC2R-700H | Recombinant Human MC2R Protein, MYC/DDK-tagged | +Inquiry |
RFL8672BF | Recombinant Full Length Bovine Adrenocorticotropic Hormone Receptor(Mc2R) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mc2r Products
Required fields are marked with *
My Review for All Mc2r Products
Required fields are marked with *
0
Inquiry Basket