Recombinant Full Length Mouse Alpha-2,8-Sialyltransferase 8B(St8Sia2) Protein, His-Tagged
Cat.No. : | RFL33580MF |
Product Overview : | Recombinant Full Length Mouse Alpha-2,8-sialyltransferase 8B(St8sia2) Protein (O35696) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | St8sia2 |
Synonyms | St8sia2; Siat8b; Stx; Alpha-2,8-sialyltransferase 8B; Polysialic acid synthase; Sialyltransferase 8B; SIAT8-B; Sialyltransferase St8Sia II; ST8SiaII; Sialyltransferase X; STX |
UniProt ID | O35696 |
◆ Recombinant Proteins | ||
ST8SIA2-5432R | Recombinant Rat ST8SIA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ST8SIA2-20H | Recombinant Human ST8SIA2 Protein (AA 60-375), N-6×His/GFP tagged | +Inquiry |
ST8SIA2-1123C | Recombinant Chicken ST8SIA2 | +Inquiry |
ST8SIA2-5773R | Recombinant Rat ST8SIA2 Protein | +Inquiry |
ST8SIA2-3319P | Recombinant Pan troglodytes (Chimpanzee) ST8SIA2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST8SIA2-1433HCL | Recombinant Human ST8SIA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All St8sia2 Products
Required fields are marked with *
My Review for All St8sia2 Products
Required fields are marked with *
0
Inquiry Basket