Recombinant Full Length Mouse B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain(Cd79A) Protein, His-Tagged
| Cat.No. : | RFL29738MF | 
| Product Overview : | Recombinant Full Length Mouse B-cell antigen receptor complex-associated protein alpha chain(Cd79a) Protein (P11911) (29-220aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length of Mature Protein (29-220) | 
| Form : | Lyophilized powder | 
| AA Sequence : | LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Applications : | SDS-PAGE | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | Cd79a | 
| Synonyms | Cd79a; Iga; Mb-1; B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a | 
| UniProt ID | P11911 | 
| ◆ Recombinant Proteins | ||
| RFL25913CF | Recombinant Full Length Dog B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain(Cd79A) Protein, His-Tagged | +Inquiry | 
| CD79A-10975H | Recombinant Human CD79A, GST-tagged | +Inquiry | 
| CD79A-153H | Recombinant Human CD79A | +Inquiry | 
| CD79A-3017C | Recombinant Cynomolgus CD79A protein, His-tagged | +Inquiry | 
| Cd79a-904MA | Recombinant Mouse Cd79a protein, Fc-tagged, APC labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CD79A-7673HCL | Recombinant Human CD79A 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd79a Products
Required fields are marked with *
My Review for All Cd79a Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            