Recombinant Full Length Mouse B-Cell Antigen Receptor Complex-Associated Protein Beta Chain(Cd79B) Protein, His-Tagged
Cat.No. : | RFL21867MF |
Product Overview : | Recombinant Full Length Mouse B-cell antigen receptor complex-associated protein beta chain(Cd79b) Protein (P15530) (26-228aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-228) |
Form : | Lyophilized powder |
AA Sequence : | VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd79b |
Synonyms | Cd79b; Igb; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b |
UniProt ID | P15530 |
◆ Recombinant Proteins | ||
CD79B-992C | Recombinant Cynomolgus/Rhesus CD79B Protein (Met1-Asp161), His-tagged | +Inquiry |
CD79B-748R | Recombinant Rhesus monkey CD79B Protein, His-tagged | +Inquiry |
CD79B-143H | Active Recombinant Human CD79B protein, His-tagged | +Inquiry |
CD79B-66HF | Recombinant Full Length Human CD79B Protein | +Inquiry |
CD79B-2995H | Recombinant Human CD79B protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd79b Products
Required fields are marked with *
My Review for All Cd79b Products
Required fields are marked with *
0
Inquiry Basket