Recombinant Full Length Mouse Bladder Cancer-Associated Protein(Blcap) Protein, His-Tagged
Cat.No. : | RFL34994MF |
Product Overview : | Recombinant Full Length Mouse Bladder cancer-associated protein(Blcap) Protein (P62951) (1-87aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-87) |
Form : | Lyophilized powder |
AA Sequence : | MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Blcap |
Synonyms | Blcap; Bc10; Bladder cancer-associated protein; Bladder cancer 10 kDa protein; Bc10 |
UniProt ID | P62951 |
◆ Recombinant Proteins | ||
BLCAP-2515H | Recombinant Human BLCAP Protein, MYC/DDK-tagged | +Inquiry |
RFL2161FF | Recombinant Full Length Cat Bladder Cancer-Associated Protein(Blcap) Protein, His-Tagged | +Inquiry |
BLCAP-236H | Recombinant Human BLCAP Protein | +Inquiry |
RFL24955BF | Recombinant Full Length Bovine Bladder Cancer-Associated Protein(Blcap) Protein, His-Tagged | +Inquiry |
BLCAP-1643HF | Recombinant Full Length Human BLCAP Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Blcap Products
Required fields are marked with *
My Review for All Blcap Products
Required fields are marked with *
0
Inquiry Basket