Recombinant Full Length Mouse Calcium-Binding Mitochondrial Carrier Protein Scamc-3(Slc25A23) Protein, His-Tagged
| Cat.No. : | RFL15716MF |
| Product Overview : | Recombinant Full Length Mouse Calcium-binding mitochondrial carrier protein SCaMC-3(Slc25a23) Protein (Q6GQS1) (1-467aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-467) |
| Form : | Lyophilized powder |
| AA Sequence : | MRGGSSDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGRGDPDRAQQGVSSDWDAD PDGGLSLEEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKI LHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSQEEKL TGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSL WRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQERFVAGSLAGATAQTIIYPME VLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKN RWLQQYSHESANPGILVLLGCGTISSTCGQIASYPLALVRTRMQAQASIEGGPQVSMVGL LRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Slc25a23 |
| Synonyms | Slc25a23; Scamc3; Calcium-binding mitochondrial carrier protein SCaMC-3; Small calcium-binding mitochondrial carrier protein 3; Solute carrier family 25 member 23 |
| UniProt ID | Q6GQS1 |
| ◆ Recombinant Proteins | ||
| RFL15716MF | Recombinant Full Length Mouse Calcium-Binding Mitochondrial Carrier Protein Scamc-3(Slc25A23) Protein, His-Tagged | +Inquiry |
| SLC25A23-8277M | Recombinant Mouse SLC25A23 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A23-4063R | Recombinant Rhesus Macaque SLC25A23 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A23-4247R | Recombinant Rhesus monkey SLC25A23 Protein, His-tagged | +Inquiry |
| SLC25A23-15309M | Recombinant Mouse SLC25A23 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A23-1623HCL | Recombinant Human SLC25A23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc25a23 Products
Required fields are marked with *
My Review for All Slc25a23 Products
Required fields are marked with *
