Recombinant Full Length Mouse Cd83 Antigen(Cd83) Protein, His-Tagged
| Cat.No. : | RFL1351MF |
| Product Overview : | Recombinant Full Length Mouse CD83 antigen(Cd83) Protein (O88324) (22-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-196) |
| Form : | Lyophilized powder |
| AA Sequence : | MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd83 |
| Synonyms | Cd83; CD83 antigen; mCD83; CD antigen CD83 |
| UniProt ID | O88324 |
| ◆ Recombinant Proteins | ||
| CD83-3751H | Recombinant Human CD83 protein, rFc-tagged | +Inquiry |
| CD83-1065H | Active Recombinant Human CD83, HIgG1 Fc-tagged | +Inquiry |
| CD83-5432H | Recombinant Human CD83 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CD83-0869H | Recombinant Human CD83 Protein, GST-Tagged | +Inquiry |
| CD83-1876H | Recombinant Human CD83 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
| CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
| CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
| CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd83 Products
Required fields are marked with *
My Review for All Cd83 Products
Required fields are marked with *
