Recombinant Full Length Mouse Ceramide Synthase 4(Cers4) Protein, His-Tagged
Cat.No. : | RFL10268MF |
Product Overview : | Recombinant Full Length Mouse Ceramide synthase 4(Cers4) Protein (Q9D6J1) (1-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-393) |
Form : | Lyophilized powder |
AA Sequence : | MSFSLSEWLWQETYWLPPNVTWAELEDRDGLVFAHPHHVLAAFPVALVLVAVRIVFERFV ALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEETQMVLLASQCGLTLRQTQRWFRR RRNQDRPSLSKKFCEACWRFVFYLCSFVGGTSILYHESWLWSPSLCWENYPHQTLNLSLY WWYLLELGFYLSLLITLPFDVKRKDFKEQVVHHFVAVGLIGFSYSVNLLRIGAVVLLLHD CSDYLLEGCKILNYAHFRRGCDALFIMFALVFFYTRLIFFPTQVIYTSVYDSIKNSGPFF GYYFFIVLLVMLQILHVYWFCLILRMLYSFLHKGQMTEDIRSDVEEPDSSDDEPVSEGPQ LKNGMARGSRVAVTNGPRSRAAACLTNGHTRAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cers4 |
Synonyms | Cers4; Lass4; Trh1; Ceramide synthase 4; CerS4; LAG1 longevity assurance homolog 4; Sphingosine N-acyltransferase CERS4; Translocating chain-associating membrane protein homolog 1; TRAM homolog 1 |
UniProt ID | Q9D6J1 |
◆ Recombinant Proteins | ||
RFL10268MF | Recombinant Full Length Mouse Ceramide Synthase 4(Cers4) Protein, His-Tagged | +Inquiry |
CERS4-2658H | Recombinant Human CERS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30215HF | Recombinant Full Length Human Ceramide Synthase 4(Cers4) Protein, His-Tagged | +Inquiry |
CERS4-1401H | Recombinant Human CERS4 | +Inquiry |
CERS4-5744H | Recombinant Human CERS4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CERS4-4818HCL | Recombinant Human LASS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cers4 Products
Required fields are marked with *
My Review for All Cers4 Products
Required fields are marked with *