Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase March5(41338) Protein, His-Tagged
Cat.No. : | RFL6639MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase MARCH5(41338) Protein (Q3KNM2) (1-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-278) |
Form : | Lyophilized powder |
AA Sequence : | MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNST ARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVT VMQVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILN SIFPGIGCPVPRIPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTIL GGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | March5 |
Synonyms | Marchf5; March5; E3 ubiquitin-protein ligase MARCHF5; Membrane-associated RING finger protein 5; Membrane-associated RING-CH protein V; MARCH-V; RING-type E3 ubiquitin transferase MARCHF5 |
UniProt ID | Q3KNM2 |
◆ Recombinant Proteins | ||
MARCH5-2121C | Recombinant Chicken MARCH5 | +Inquiry |
RFL4530DF | Recombinant Full Length Danio Rerio E3 Ubiquitin-Protein Ligase March5(41338) Protein, His-Tagged | +Inquiry |
MARCH5-5228Z | Recombinant Zebrafish MARCH5 | +Inquiry |
MARCH5-2501R | Recombinant Rhesus Macaque MARCH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCH5-5366M | Recombinant Mouse MARCH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCH5-4470HCL | Recombinant Human MARCH5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All March5 Products
Required fields are marked with *
My Review for All March5 Products
Required fields are marked with *