Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf144B(Rnf144B) Protein, His-Tagged
| Cat.No. : | RFL31695MF |
| Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase RNF144B(Rnf144b) Protein (Q8BKD6) (1-301aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-301) |
| Form : | Lyophilized powder |
| AA Sequence : | MDSVDGLQCLTMTAENPPSGDLIPAPLVTCKLCLCEQSLDKMTMLQECQCIFCTPCLKQY MVLSIREGCGSPITCPDMVCLNHGTLQETEIACLVPLDEFQLYQRLKFEREVHMDPLRTW CPVADCQTVCHISAGDPGQPVLVECPSCHLKFCSCCKDAWHEESSCRDSQSAMPEHGALF GTDADAPIKQCPVCRIYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRN KLGHSRASVMWNRTQVVGILVGLGVIALVTSPLLLLASPCIICCVCKSCRGKKKKHDPST T |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Rnf144b |
| Synonyms | Rnf144b; Ibrdc2; E3 ubiquitin-protein ligase RNF144B; IBR domain-containing protein 2; RING finger protein 144B |
| UniProt ID | Q8BKD6 |
| ◆ Recombinant Proteins | ||
| RNF144B-683H | Recombinant Human RNF144B Protein, GST/His-tagged | +Inquiry |
| RNF144B-7685H | Recombinant Human RNF144B protein, GST-tagged | +Inquiry |
| RFL3160BF | Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase Rnf144B(Rnf144B) Protein, His-Tagged | +Inquiry |
| RFL31695MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf144B(Rnf144B) Protein, His-Tagged | +Inquiry |
| RNF144B-3932R | Recombinant Rhesus monkey RNF144B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF144B-2293HCL | Recombinant Human RNF144B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rnf144b Products
Required fields are marked with *
My Review for All Rnf144b Products
Required fields are marked with *
