Recombinant Full Length Mouse Elongation Of Very Long Chain Fatty Acids Protein 3(Elovl3) Protein, His-Tagged
Cat.No. : | RFL21722MF |
Product Overview : | Recombinant Full Length Mouse Elongation of very long chain fatty acids protein 3(Elovl3) Protein (O35949) (1-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-271) |
Form : | Lyophilized powder |
AA Sequence : | MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRK SFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFL FLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHS VMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWS FMLYGTYFILFAHFFHRAYLRPKGKVASKSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Elovl3 |
Synonyms | Elovl3; Cig30; Elongation of very long chain fatty acids protein 3; 3-keto acyl-CoA synthase Elovl3; CIN-2; Cold-inducible glycoprotein of 30 kDa; ELOVL fatty acid elongase 3; ELOVL FA elongase 3; Very long chain 3-ketoacyl-CoA synthase 3; Very long chain |
UniProt ID | O35949 |
◆ Recombinant Proteins | ||
Elovl3-4010M | Recombinant Mouse Elovl3 Protein (Asp110-Gly169), N-His tagged | +Inquiry |
ELOVL3-5149M | Recombinant Mouse ELOVL3 Protein | +Inquiry |
ELOVL3-2751M | Recombinant Mouse ELOVL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOVL3-1276R | Recombinant Rhesus Macaque ELOVL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14295HF | Recombinant Full Length Human Elongation Of Very Long Chain Fatty Acids Protein 3(Elovl3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Elovl3 Products
Required fields are marked with *
My Review for All Elovl3 Products
Required fields are marked with *