Recombinant Full Length Mouse Epidermal Retinol Dehydrogenase 2(Sdr16C5) Protein, His-Tagged
| Cat.No. : | RFL6103MF |
| Product Overview : | Recombinant Full Length Mouse Epidermal retinol dehydrogenase 2(Sdr16c5) Protein (Q7TQA3) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-309) |
| Form : | Lyophilized powder |
| AA Sequence : | MSQNLESVKNLLVFLGKSLLSVLEALLFHVISKPRKNVAGEIVLITGAGSGLGRLLALQF ARLGAVLVLWDVNKEANDETHQLAREAGAARVHAYTCDCSRREEVYRVADQVKKEVGDVS ILINNAGIVTGRNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSAG LIGVNGLSDYCASKFAALGFAESMFIETLAKKQWGIKTTIVCPFFIKTGMFEGCTTKCPT LLPILDPEYAVRKIIDAILQEQLYLYMPKFLYFIVFLKSILPIKTGILIADYLGVFHMTE GFTGQKKKT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Sdr16c5 |
| Synonyms | Sdr16c5; Rdhe2; Scdr9; Epidermal retinol dehydrogenase 2; EPHD-2; RDH-E2; Retinal short-chain dehydrogenase reductase 2; retSDR2; Short-chain dehydrogenase reductase 9; Short-chain dehydrogenase/reductase family 16C member 5 |
| UniProt ID | Q7TQA3 |
| ◆ Recombinant Proteins | ||
| RFL6103MF | Recombinant Full Length Mouse Epidermal Retinol Dehydrogenase 2(Sdr16C5) Protein, His-Tagged | +Inquiry |
| SDR16C5-7549H | Recombinant Human SDR16C5, His-tagged | +Inquiry |
| SDR16C5-2702C | Recombinant Chicken SDR16C5 | +Inquiry |
| SDR16C5-7973M | Recombinant Mouse SDR16C5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SDR16C5-01H | Recombiant Human SDR16C5 Protein, DYKDDDDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SDR16C5-2007HCL | Recombinant Human SDR16C5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sdr16c5 Products
Required fields are marked with *
My Review for All Sdr16c5 Products
Required fields are marked with *
